Ver mas grande
CCL22 (Human) Recombinant Protein
AB-P9523
Producto nuevo
CCL22 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CCL22 |
| Gene Alias | A-152E5.1|ABCD-1|DC/B-CK|MDC|MGC34554|SCYA22|STCP-1 |
| Gene Description | chemokine (C-C motif) ligand 22 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 6367 |
Más información
Human CCL22 (O00626, 25 a.a. - 93 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.