AB-P9522
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 20 ug |
Gene Name | CCL22 |
Gene Alias | A-152E5.1|ABCD-1|DC/B-CK|MDC|MGC34554|SCYA22|STCP-1 |
Gene Description | chemokine (C-C motif) ligand 22 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Immunogen Prot. Seq | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ |
Form | Lyophilized |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Storage Buffer | Lyophilized from sterile distilled Water is > |
Gene ID | 6367 |