Ver mas grande
Xcl1 (Rat) Recombinant Protein
AB-P9504
Producto nuevo
Xcl1 (Rat) Recombinant Protein
Comprando este producto generará 9 Biopuntos. Su cesta contiene un total 9 Biopuntos puede ser convertido en un Biobonos Descuento 36.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Xcl1 |
| Gene Alias | Ltn|Scyc1 |
| Gene Description | chemokine (C motif) ligand 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 171371 |
Más información
Rat Xcl1 (P51672, 22 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.