Cxcl11 (Mouse) Recombinant Protein Ver mas grande

Cxcl11 (Mouse) Recombinant Protein

AB-P9497

Producto nuevo

Cxcl11 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Cxcl11
Gene Alias CXC11|H174|I-TAC|IP9|ITAC|SCYB9B|Scyb11|b-R1|betaR1
Gene Description chemokine (C-X-C motif) ligand 11
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 56066

Más información

Mouse Cxcl11 (Q9JHH5, 22 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Cxcl11 (Mouse) Recombinant Protein

Cxcl11 (Mouse) Recombinant Protein