Ver mas grande
Cxcl10 (Mouse) Recombinant Protein
AB-P9491
Producto nuevo
Cxcl10 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Cxcl10 |
| Gene Alias | C7|CRG-2|INP10|IP-10|IP10|Ifi10|Scyb10|gIP-10|mob-1 |
| Gene Description | chemokine (C-X-C motif) ligand 10 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 15945 |
Más información
Mouse Cxcl10 (P17515, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.