CXCL8 (Human) Recombinant Protein
  • CXCL8 (Human) Recombinant Protein

CXCL8 (Human) Recombinant Protein

Ref: AB-P9482
CXCL8 (Human) Recombinant Protein

Información del producto

Human CXCL8 (P10145, 23 a.a. - 99 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name IL8
Gene Alias CXCL8|GCP-1|GCP1|LECT|LUCT|LYNAP|MDNCF|MONAP|NAF|NAP-1|NAP1
Gene Description interleukin 8
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 3576

Enviar un mensaje


CXCL8 (Human) Recombinant Protein

CXCL8 (Human) Recombinant Protein