Ver mas grande
CCL1 (Human) Recombinant Protein
AB-P9479
Producto nuevo
CCL1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CCL1 |
| Gene Alias | I-309|P500|SCYA1|SISe|TCA3 |
| Gene Description | chemokine (C-C motif) ligand 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 7.5 (1 M DTT, 50 mM NaCl and 10% glycerol) |
| Gene ID | 6346 |
Más información
Human CCL1 (P22362, 24 a.a. - 96 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.