Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CCL14 (Human) Recombinant Protein
Abnova
CCL14 (Human) Recombinant Protein
Ref: AB-P9477
CCL14 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CCL14 (Q16627, 20 a.a. - 93 a.a.) partial recombinant protein with His tag at N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
CCL14
Gene Alias
CC-1|CC-3|CKb1|HCC-1|HCC-3|MCIF|NCC-2|NCC2|SCYA14|SCYL2|SY14
Gene Description
chemokine (C-C motif) ligand 14
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Form
Liquid
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
In PBS pH 7.4 (10% glycerol)
Gene ID
6358
Enviar un mensaje
CCL14 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*