Cxcl3 (Rat) Recombinant Protein
  • Cxcl3 (Rat) Recombinant Protein

Cxcl3 (Rat) Recombinant Protein

Ref: AB-P9474
Cxcl3 (Rat) Recombinant Protein

Información del producto

Rat Cxcl3 (Q10746, 33 a.a. - 100 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Cxcl3
Gene Alias Cinc-2|Cinc2|Gm1960
Gene Description chemokine (C-X-C motif) ligand 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSPSL
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 171551

Enviar un mensaje


Cxcl3 (Rat) Recombinant Protein

Cxcl3 (Rat) Recombinant Protein