Ver mas grande
Cxcl3 (Mouse) Recombinant Protein
AB-P9472
Producto nuevo
Cxcl3 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Cxcl3 |
| Gene Alias | Dcip1|Gm1960 |
| Gene Description | chemokine (C-X-C motif) ligand 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (5 M DTT, 0.15 M NaCl and 50% glycerol) |
| Gene ID | 330122 |
Más información
Mouse Cxcl3 (Q6W5C0, 32 a.a. - 100 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.