CXCL3 (Human) Recombinant Protein
  • CXCL3 (Human) Recombinant Protein

CXCL3 (Human) Recombinant Protein

Ref: AB-P9469
CXCL3 (Human) Recombinant Protein

Información del producto

Human CXCL3 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CXCL3
Gene Alias CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3
Gene Description chemokine (C-X-C motif) ligand 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 2921

Enviar un mensaje


CXCL3 (Human) Recombinant Protein

CXCL3 (Human) Recombinant Protein