Cxcl1 (Mouse) Recombinant Protein
  • Cxcl1 (Mouse) Recombinant Protein

Cxcl1 (Mouse) Recombinant Protein

Ref: AB-P9461
Cxcl1 (Mouse) Recombinant Protein

Información del producto

Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Cxcl1
Gene Alias Fsp|Gro1|KC|Mgsa|N51|Scyb1|gro
Gene Description chemokine (C-X-C motif) ligand 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 14825

Enviar un mensaje


Cxcl1 (Mouse) Recombinant Protein

Cxcl1 (Mouse) Recombinant Protein