Ver mas grande
Cxcl1 (Mouse) Recombinant Protein
AB-P9461
Producto nuevo
Cxcl1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Cxcl1 |
| Gene Alias | Fsp|Gro1|KC|Mgsa|N51|Scyb1|gro |
| Gene Description | chemokine (C-X-C motif) ligand 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 14825 |
Más información
Mouse Cxcl1 (P12850, 25 a.a. - 96 a.a.) partial recombinant protein expressed in Escherichia coli.