CXCL6 (Human) Recombinant Protein
  • CXCL6 (Human) Recombinant Protein

CXCL6 (Human) Recombinant Protein

Ref: AB-P9457
CXCL6 (Human) Recombinant Protein

Información del producto

Human CXCL6 (P80162, 43 a.a. - 114 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CXCL6
Gene Alias CKA-3|GCP-2|GCP2|SCYB6
Gene Description chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 6372

Enviar un mensaje


CXCL6 (Human) Recombinant Protein

CXCL6 (Human) Recombinant Protein