Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CCL21 (Human) Recombinant Protein
Abnova
CCL21 (Human) Recombinant Protein
Ref: AB-P9448
CCL21 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CCL21 (O00585, 24 a.a. - 134 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CCL21
Gene Alias
6Ckine|CKb9|ECL|MGC34555|SCYA21|SLC|TCA4
Gene Description
chemokine (C-C motif) ligand 21
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCRKTERSQTPKGP
Form
Lyophilized
Recomended Dilution
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer
Lyophilized from sterile distilled Water is >
Gene ID
6366
Enviar un mensaje
CCL21 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*