Ccl24 (Rat) Recombinant Protein
  • Ccl24 (Rat) Recombinant Protein

Ccl24 (Rat) Recombinant Protein

Ref: AB-P9446
Ccl24 (Rat) Recombinant Protein

Información del producto

Rat Ccl24 (Q5PPP2, 27 a.a. - 119 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl24
Gene Alias -
Gene Description chemokine (C-C motif) ligand 24
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VTIPSSCCVTFISKKIPVNRVISYQLANGSICPKAGVIFITKKGHKICTDPKLPWVQKHIKNLDAKRNQPSEGAKALGPKFVIQKLRGNSTKV
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 288593

Enviar un mensaje


Ccl24 (Rat) Recombinant Protein

Ccl24 (Rat) Recombinant Protein