Ccl24 (Mouse) Recombinant Protein
  • Ccl24 (Mouse) Recombinant Protein

Ccl24 (Mouse) Recombinant Protein

Ref: AB-P9445
Ccl24 (Mouse) Recombinant Protein

Información del producto

Mouse Ccl24 (Q9JKC0, 27 a.a. - 119 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Ccl24
Gene Alias CKb-6|MPIF-2|Scya24
Gene Description chemokine (C-C motif) ligand 24
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.
Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 56221

Enviar un mensaje


Ccl24 (Mouse) Recombinant Protein

Ccl24 (Mouse) Recombinant Protein