Ver mas grande
Ccl27a (Mouse) Recombinant Protein
AB-P9429
Producto nuevo
Ccl27a (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ccl27a |
| Gene Alias | ALP|AW558992|CTACK|CTAK|Ccl27|Ccl27b|ESkine|ILC|MGC130150|PESKY|Scya27|Scya27a|Scya27b|mILC |
| Gene Description | chemokine (C-C motif) ligand 27A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 20301 |
Más información
Mouse Ccl27a (Q9Z1X0, 26 a.a. - 120 a.a.) partial recombinant protein expressed in Escherichia coli.