CCL3L1 (Human) Recombinant Protein
  • CCL3L1 (Human) Recombinant Protein

CCL3L1 (Human) Recombinant Protein

Ref: AB-P9427
CCL3L1 (Human) Recombinant Protein

Información del producto

Human CCL3L1 (P16619, 24 a.a. - 93 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CCL3L1
Gene Alias 464.2|D17S1718|G0S19-2|LD78|LD78BETA|MGC104178|MGC12815|MGC182017|MIP1AP|SCYA3L|SCYA3L1
Gene Description chemokine (C-C motif) ligand 3-like 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 6349

Enviar un mensaje


CCL3L1 (Human) Recombinant Protein

CCL3L1 (Human) Recombinant Protein