CCL3L1 (Human) Recombinant Protein Ver mas grande

CCL3L1 (Human) Recombinant Protein

AB-P9427

Producto nuevo

CCL3L1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name CCL3L1
Gene Alias 464.2|D17S1718|G0S19-2|LD78|LD78BETA|MGC104178|MGC12815|MGC182017|MIP1AP|SCYA3L|SCYA3L1
Gene Description chemokine (C-C motif) ligand 3-like 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 6349

Más información

Human CCL3L1 (P16619, 24 a.a. - 93 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

CCL3L1 (Human) Recombinant Protein

CCL3L1 (Human) Recombinant Protein