MFAP2 (Human) Recombinant Protein
  • MFAP2 (Human) Recombinant Protein

MFAP2 (Human) Recombinant Protein

Ref: AB-P9402
MFAP2 (Human) Recombinant Protein

Información del producto

Human MFAP2 (P55001, 18 a.a. - 183 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name MFAP2
Gene Alias MAGP|MAGP-1|MAGP1
Gene Description microfibrillar-associated protein 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl pH 8.0 (1 M Urea and 20% glycerol)
Gene ID 4237

Enviar un mensaje


MFAP2 (Human) Recombinant Protein

MFAP2 (Human) Recombinant Protein