CDH1 (Human) Recombinant Protein
  • CDH1 (Human) Recombinant Protein

CDH1 (Human) Recombinant Protein

Ref: AB-P9364
CDH1 (Human) Recombinant Protein

Información del producto

Human CDH1 partial recombinant protein with His tag in C-terminus expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name CDH1
Gene Alias Arc-1|CD324|CDHE|ECAD|LCAM|UVO
Gene Description cadherin 1, type 1, E-cadherin (epithelial)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAW
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1XPBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 999

Enviar un mensaje


CDH1 (Human) Recombinant Protein

CDH1 (Human) Recombinant Protein