Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CDH1 (Human) Recombinant Protein
Abnova
CDH1 (Human) Recombinant Protein
Ref: AB-P9363
CDH1 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CDH1 partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
5 ug
Gene Name
CDH1
Gene Alias
Arc-1|CD324|CDHE|ECAD|LCAM|UVO
Gene Description
cadherin 1, type 1, E-cadherin (epithelial)
Storage Conditions
Lyophilized protein should be stored at -20C to -80C can stable for 12 months.
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
IFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQI
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution (100 ug/mL) containing 50 mM Tris-HCl, pH 7.5, 10 mM L-glutathione (reduced).
Gene ID
999
Enviar un mensaje
CDH1 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*