Ver mas grande
CD300A (Human) Recombinant Protein
AB-P9354
Producto nuevo
CD300A (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CD300A |
| Gene Alias | CMRF-35-H9|CMRF-35H|CMRF35H|CMRF35H9|IGSF12|IRC1|IRC2|IRp60 |
| Gene Description | CD300a molecule |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSLSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPAS |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.15 M NaCl, 1 mM DTT. |
| Gene ID | 11314 |
Más información
Human CD300A partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.