CD93 (Human) Recombinant Protein Ver mas grande

CD93 (Human) Recombinant Protein

AB-P9340

Producto nuevo

CD93 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 5 ug
Gene Name CD93
Gene Alias C1QR1|C1qR(P)|C1qRP|CDw93|MXRA4|dJ737E23.1
Gene Description CD93 molecule
Storage Conditions Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCF
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 22918

Más información

Human CD93 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.

Consulta sobre un producto

CD93 (Human) Recombinant Protein

CD93 (Human) Recombinant Protein