CD86 (Human) Recombinant Protein
  • CD86 (Human) Recombinant Protein

CD86 (Human) Recombinant Protein

Ref: AB-P9338
CD86 (Human) Recombinant Protein

Información del producto

Human CD86 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 20 ug
Gene Name CD86
Gene Alias B7-2|B70|CD28LG2|LAB72|MGC34413
Gene Description CD86 molecule
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq YFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 942

Enviar un mensaje


CD86 (Human) Recombinant Protein

CD86 (Human) Recombinant Protein