CCN5 (Human) Recombinant Protein
  • CCN5 (Human) Recombinant Protein

CCN5 (Human) Recombinant Protein

Ref: AB-P9334
CCN5 (Human) Recombinant Protein

Información del producto

Human CCN5 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name WISP2
Gene Alias CCN5|CT58|CTGF-L
Gene Description WNT1 inducible signaling pathway protein 2
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 0.1% Trifluoroacetic Acid (TFA). Reconstitute the lyophilized powder in 10 mM acetic acid to 100 ug/mL.
Gene ID 8839

Enviar un mensaje


CCN5 (Human) Recombinant Protein

CCN5 (Human) Recombinant Protein