Ver mas grande
TNFSF15 (Human) Recombinant Protein
AB-P9328
Producto nuevo
TNFSF15 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | TNFSF15 |
| Gene Alias | MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 15 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution containing 1XPBS, pH 7.4, 0.02% Tween 20. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 9966 |
Más información
Human TNFSF15 recombinant protein expressed in Escherichia coli.