TNFSF15 (Human) Recombinant Protein
  • TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein

Ref: AB-P9328
TNFSF15 (Human) Recombinant Protein

Información del producto

Human TNFSF15 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name TNFSF15
Gene Alias MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene Description tumor necrosis factor (ligand) superfamily, member 15
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1XPBS, pH 7.4, 0.02% Tween 20. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 9966

Enviar un mensaje


TNFSF15 (Human) Recombinant Protein

TNFSF15 (Human) Recombinant Protein