VEGFC (Human) Recombinant Protein
  • VEGFC (Human) Recombinant Protein

VEGFC (Human) Recombinant Protein

Ref: AB-P9322
VEGFC (Human) Recombinant Protein

Información del producto

Human VEGFC partial recombinant proteind with His tag in C-terminus expressed in HEK293 cells.
Información adicional
Size 20 ug
Gene Name VEGFC
Gene Alias Flt4-L|VRP
Gene Description vascular endothelial growth factor C
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C for long term storage.
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 20 mM Tris-HCl, pH 7.2, 150 mM NaCl. Reconstitute the lyophilized powder in 1XPBS to 100 ug/mL.
Gene ID 7424

Enviar un mensaje


VEGFC (Human) Recombinant Protein

VEGFC (Human) Recombinant Protein