VEGFA (Equine) Recombinant Protein
  • VEGFA (Equine) Recombinant Protein

VEGFA (Equine) Recombinant Protein

Ref: AB-P9320
VEGFA (Equine) Recombinant Protein

Información del producto

Equine Vegfa recombinant protein expressed in?Escherichia coli.
Información adicional
Size 50 ug
Gene Name LOC100033839
Gene Alias -
Gene Description vascular endothelial growth factor 164
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MAPMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Form Lyophilized
Storage Buffer Lyophilized from a solution containing 10 mM Sodium Phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 0.1 mg/mL.
Gene ID 100033839

Enviar un mensaje


VEGFA (Equine) Recombinant Protein

VEGFA (Equine) Recombinant Protein