Ver mas grande
Vegfa (Rat) Recombinant Protein
AB-P9317
Producto nuevo
Vegfa (Rat) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Vegfa |
| Gene Alias | VEGF164|Vegf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Form | Liquid |
| Antigen species Target species | Rat |
| Storage Buffer | Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 50% glycerol. |
| Gene ID | 83785 |
Más información
Rat Vegfa partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.