AB-P9314
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 12 Biopuntos. Su cesta contiene un total 12 Biopuntos puede ser convertido en un Biobonos Descuento 48.00EUR.
Size | 100 ug |
Gene Name | Vegfa |
Gene Alias | Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf |
Gene Description | vascular endothelial growth factor A |
Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Form | Lyophilized |
Antigen species Target species | Mouse |
Storage Buffer | Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
Gene ID | 22339 |