Ver mas grande
Vegfa (Mouse) Recombinant Protein
AB-P9313
Producto nuevo
Vegfa (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Vegfa |
| Gene Alias | Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution containing 20 mM Tris-HCl, pH 8.0, 10% glycerol. |
| Gene ID | 22339 |
Más información
Mouse Vegfa partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.