Ver mas grande
VEGFA (Human) Recombinant Protein
AB-P9305
Producto nuevo
VEGFA (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | VEGFA |
| Gene Alias | MGC70609|VEGF|VEGF-A|VPF |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 30% glycerol, 1 mM PMSF, 1 mM DTT. |
| Gene ID | 7422 |
Más información
Human VEGFA partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.