AB-P9300
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 2 x 10 ug |
Gene Name | VEGFA |
Gene Alias | MGC70609|VEGF|VEGF-A|VPF |
Gene Description | vascular endothelial growth factor A |
Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
Immunogen Prot. Seq | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Form | Lyophilized |
Antigen species Target species | Human |
Storage Buffer | Protein (1 mg/mL) was lyophilized with no additives. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
Gene ID | 7422 |