Tnfsf10 (Mouse) Recombinant Protein
  • Tnfsf10 (Mouse) Recombinant Protein

Tnfsf10 (Mouse) Recombinant Protein

Ref: AB-P9295
Tnfsf10 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfsf10 recombinant protein expressed in?Escherichia coli.
Información adicional
Size 50 ug
Gene Name Tnfsf10
Gene Alias A330042I21Rik|AI448571|APO-2L|Ly81|TL2|Trail
Gene Description tumor necrosis factor (ligand) superfamily, member 10
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4, 3 mM DTT. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 22035

Enviar un mensaje


Tnfsf10 (Mouse) Recombinant Protein

Tnfsf10 (Mouse) Recombinant Protein