Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
TSLP (Human) Recombinant Protein
Abnova
TSLP (Human) Recombinant Protein
Ref: AB-P9282
TSLP (Human) Recombinant Protein
Contáctenos
Información del producto
Human TSLP partial recombinant protein with His tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
TSLP
Gene Alias
-
Gene Description
thymic stromal lymphopoietin
Storage Conditions
Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MKHHHHHHASYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from 1X PBS. Reconstitute the lyophilized powder in ddH
2
O to 0.5 mg/mL, and is not sterile! Please filter the product by an sterile filter before use.
Gene ID
85480
Enviar un mensaje
TSLP (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*