Ver mas grande
TNFRSF17 (Human) Recombinant Protein
AB-P9275
Producto nuevo
TNFRSF17 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | TNFRSF17 |
| Gene Alias | BCM|BCMA|CD269 |
| Gene Description | tumor necrosis factor receptor superfamily, member 17 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | 1 mg protein lyophilized from a solution containing 20 mM sodium phosphate buffer, pH 7.4, 130 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 608 |
Más información
Human TNFRSF17 recombinant protein expressed in Escherichia coli.