AB-P9273
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 20 ug |
Gene Name | Tnfsf14 |
Gene Alias | HVEM-L|HVEML|LIGHT|LTg|Ly113 |
Gene Description | tumor necrosis factor (ligand) superfamily, member 14 |
Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
Immunogen Prot. Seq | DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV |
Form | Lyophilized |
Antigen species Target species | Mouse |
Storage Buffer | Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in sterile 100 mM HAc to 100 ug/mL. |
Gene ID | 50930 |