TNFSF14 (Human) Recombinant Protein
  • TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein

Ref: AB-P9270
TNFSF14 (Human) Recombinant Protein

Información del producto

Human TNFSF14 partial recombinant proteind with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSLPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 M NaCl.
Gene ID 8740

Enviar un mensaje


TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein