TNFSF14 (Human) Recombinant Protein Ver mas grande

TNFSF14 (Human) Recombinant Protein

AB-P9269

Producto nuevo

TNFSF14 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name TNFSF14
Gene Alias CD258|HVEML|LIGHT|LTg|TR2
Gene Description tumor necrosis factor (ligand) superfamily, member 14
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4, 3 % Trehalose. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 8740

Más información

Human TNFSF14 recombinant proteind expressed in Pichia Pastoris.

Consulta sobre un producto

TNFSF14 (Human) Recombinant Protein

TNFSF14 (Human) Recombinant Protein