TNFRSF12A (Human) Recombinant Protein
  • TNFRSF12A (Human) Recombinant Protein

TNFRSF12A (Human) Recombinant Protein

Ref: AB-P9267
TNFRSF12A (Human) Recombinant Protein

Información del producto

Human TNFRSF12A recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name TNFRSF12A
Gene Alias CD266|FN14|TWEAKR
Gene Description tumor necrosis factor receptor superfamily, member 12A
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 51330

Enviar un mensaje


TNFRSF12A (Human) Recombinant Protein

TNFRSF12A (Human) Recombinant Protein