Ver mas grande
TNFRSF10D (Human) Recombinant Protein
AB-P9265
Producto nuevo
TNFRSF10D (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | TNFRSF10D |
| Gene Alias | CD264|DCR2|TRAILR4|TRUNDD |
| Gene Description | tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYHVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.5mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 8793 |
Más información
Human TNFRSF10D partial recombinant protein with hIgG-His tag in C-terminus expressed in Baculovirus cells.