Ver mas grande
TNFRSF8 (Human) Recombinant Protein
AB-P9257
Producto nuevo
TNFRSF8 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | TNFRSF8 |
| Gene Alias | CD30|D1S166E|KI-1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 8 |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | ADPFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEK |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 943 |
Más información
Human TNFRSF8 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.