Ver mas grande
TNFSF8 (Human) Recombinant Protein
AB-P9255
Producto nuevo
TNFSF8 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | TNFSF8 |
| Gene Alias | CD153|CD30L|CD30LG|MGC138144 |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 8 |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.4 M Urea. |
| Gene ID | 944 |
Más información
Human TNFSF8 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.