CD70 (Human) Recombinant Protein
  • CD70 (Human) Recombinant Protein

CD70 (Human) Recombinant Protein

Ref: AB-P9253
CD70 (Human) Recombinant Protein

Información del producto

Human CD70 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CD70
Gene Alias CD27L|CD27LG|TNFSF7
Gene Description CD70 molecule
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP.
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol.
Gene ID 970

Enviar un mensaje


CD70 (Human) Recombinant Protein

CD70 (Human) Recombinant Protein