Tnfrsf4 (Mouse) Recombinant Protein
  • Tnfrsf4 (Mouse) Recombinant Protein

Tnfrsf4 (Mouse) Recombinant Protein

Ref: AB-P9250
Tnfrsf4 (Mouse) Recombinant Protein

Información del producto

Mouse Tnfrsf4 partial recombinant protein with hIgG-His tag in C-terminus expressed in HEK293 Cells.
Información adicional
Size 2 x 10 ug
Gene Name Tnfrsf4
Gene Alias ACT35|CD134|Ly-70|Ox40|TXGP1L|Txgp1
Gene Description tumor necrosis factor receptor superfamily, member 4
Storage Conditions Store at 4C for one weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq DGSMVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.25 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 22163

Enviar un mensaje


Tnfrsf4 (Mouse) Recombinant Protein

Tnfrsf4 (Mouse) Recombinant Protein