TNFRSF1B (Human) Recombinant Protein Ver mas grande

TNFRSF1B (Human) Recombinant Protein

AB-P9244

Producto nuevo

TNFRSF1B (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name TNFRSF1B
Gene Alias CD120b|TBPII|TNF-R-II|TNF-R75|TNFBR|TNFR1B|TNFR2|TNFR80|p75|p75TNFR
Gene Description tumor necrosis factor receptor superfamily, member 1B
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq MPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 7133

Más información

Human TNFRSF1B recombinant proteind expressed in Escherichia coli.

Consulta sobre un producto

TNFRSF1B (Human) Recombinant Protein

TNFRSF1B (Human) Recombinant Protein