Ver mas grande
Tnfrsf1a (Mouse) Recombinant Protein
AB-P9243
Producto nuevo
Tnfrsf1a (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Tnfrsf1a |
| Gene Alias | CD120a|FPF|TNF-R|TNF-R-I|TNF-R1|TNF-R55|TNF-alphaR1|TNFAR|TNFR60|TNFRI|TNFRp55|Tnfr-2|Tnfr1|p55|p55-R |
| Gene Description | tumor necrosis factor receptor superfamily, member 1a |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | IHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 21937 |
Más información
Mouse Tnfrsf1a recombinant protein expressed in Escherichia coli.