Ver mas grande
TNFRSF1A (Human) Recombinant Protein
AB-P9242
Producto nuevo
TNFRSF1A (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | TNFRSF1A |
| Gene Alias | CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60 |
| Gene Description | tumor necrosis factor receptor superfamily, member 1A |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol. |
| Gene ID | 7132 |
Más información
Human TNFRSF1A partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.