Ver mas grande
TNF (Human) Recombinant Protein
AB-P9234
Producto nuevo
TNF (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | TNF |
| Gene Alias | DIF|TNF-alpha|TNFA|TNFSF2 |
| Gene Description | tumor necrosis factor (TNF superfamily, member 2) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MRKRKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | The protein after extensive dialysis against was lyophilized in 0.5X PBS, pH 7.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 7124 |
Más información
Human TNF recombinant protein expressed in Escherichia coli.