TNF (Bovine) Recombinant Protein Ver mas grande

TNF (Bovine) Recombinant Protein

AB-P9233

Producto nuevo

TNF (Bovine) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name TNF
Gene Alias TNFa
Gene Description tumor necrosis factor (TNF superfamily, member 2)
Storage Conditions Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL.
Form Liquid
Antigen species Target species Bovine
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 280943

Más información

Bovine TNF partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

TNF (Bovine) Recombinant Protein

TNF (Bovine) Recombinant Protein