Ver mas grande
TNF (Bovine) Recombinant Protein
AB-P9233
Producto nuevo
TNF (Bovine) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | TNF |
| Gene Alias | TNFa |
| Gene Description | tumor necrosis factor (TNF superfamily, member 2) |
| Storage Conditions | Store at 4ºC for one weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MLRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL. |
| Form | Liquid |
| Antigen species Target species | Bovine |
| Storage Buffer | Solution (1 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 280943 |
Más información
Bovine TNF partial recombinant protein expressed in Escherichia coli.